Recombinant Human GLP1R Protein (24-145 aa), His-tagged
Cat.No. : | GLP1R-2802H |
Product Overview : | Recombinant Human GLP1R Protein (24-145 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 24-145 aa |
Description : | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.8 kDa |
AA Sequence : | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ] |
Official Symbol | GLP1R |
Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331; |
Gene ID | 2740 |
mRNA Refseq | NM_002062 |
Protein Refseq | NP_002053 |
MIM | 138032 |
UniProt ID | P43220 |
◆ Recombinant Proteins | ||
GLP1R-2755H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
GLP1R-5019H | Recombinant Human GLP1R protein, His-tagged | +Inquiry |
GLP1R-1932H | Active Recombinant Human GLP1R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
GLP1R-294C | Recombinant Cynomolgus Monkey GLP1R Protein, His (Fc)-Avi-tagged | +Inquiry |
GLP1R-583H | Recombinant Human GLP1R Protein, hFc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *