Recombinant Human GLP1R Protein (24-145 aa), His-tagged

• Cat.No.: GLP1R-2802H
• Product Overview: Recombinant Human GLP1R Protein (24-145 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 24-145 aa
• Description: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.8 kDa
• AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
• Gene ID: 2740
• mRNA Refseq: NM_002062
• Protein Refseq: NP_002053
• MIM: 138032
• UniProt ID: P43220