Recombinant Human GLP1R protein, His&Myc-tagged

Cat.No. : GLP1R-4643H
Product Overview : Recombinant Human GLP1R protein(P43220)(24-145aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&Myc
Protein Length : 24-145aa
Tag : N-His&C-Myc
Form : Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL.
Molecular Mass : 19.3 kDa
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Gene Name GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ]
Official Symbol GLP1R
Synonyms GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331;
Gene ID 2740
mRNA Refseq NM_002062
Protein Refseq NP_002053
MIM 138032
UniProt ID P43220

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLP1R Products

Required fields are marked with *

My Review for All GLP1R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon