Recombinant Human GLP1R protein, His&Myc-tagged

• Cat.No.: GLP1R-4643H
• Product Overview: Recombinant Human GLP1R protein(P43220)(24-145aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Myc
• Protein Length: 24-145aa
• Tag: N-His&C-Myc
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL.
• Molecular Mass: 19.3 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Gene Information

• Gene Name: GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ]
• Official Symbol: GLP1R
• Synonyms: GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
• Gene ID: 2740
• mRNA Refseq: NM_002062
• Protein Refseq: NP_002053
• MIM: 138032
• UniProt ID: P43220