Recombinant Human GLRX protein, GST-tagged
Cat.No. : | GLRX-2968H |
Product Overview : | Recombinant Human GLRX protein(P35754)(1-106aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-106aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GLRX glutaredoxin (thioltransferase) [ Homo sapiens ] |
Official Symbol | GLRX |
Synonyms | GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407; |
Gene ID | 2745 |
mRNA Refseq | NM_001118890 |
Protein Refseq | NP_001112362 |
MIM | 600443 |
UniProt ID | P35754 |
◆ Recombinant Proteins | ||
Glrx-3229M | Recombinant Mouse Glrx Protein, Myc/DDK-tagged | +Inquiry |
GLRX-78H | Recombinant Human GLRX | +Inquiry |
GLRX-139H | Recombinant Human GLRX Protein, His-tagged | +Inquiry |
GLRX-6716C | Recombinant Chicken GLRX | +Inquiry |
GLRX-154H | Recombinant Human GLRX Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX-5898HCL | Recombinant Human GLRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX Products
Required fields are marked with *
My Review for All GLRX Products
Required fields are marked with *