Recombinant Human GLRX protein, GST-tagged
| Cat.No. : | GLRX-2968H |
| Product Overview : | Recombinant Human GLRX protein(P35754)(1-106aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-106aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.8 kDa |
| AA Sequence : | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GLRX glutaredoxin (thioltransferase) [ Homo sapiens ] |
| Official Symbol | GLRX |
| Synonyms | GLRX; glutaredoxin (thioltransferase); glutaredoxin-1; GRX; GRX1; TTase-1; thioltransferase-1; FLJ43648; MGC117407; |
| Gene ID | 2745 |
| mRNA Refseq | NM_001118890 |
| Protein Refseq | NP_001112362 |
| MIM | 600443 |
| UniProt ID | P35754 |
| ◆ Recombinant Proteins | ||
| GLRX-368H | Recombinant Human GLRX, His tagged | +Inquiry |
| GLRX-166H | Recombinant Human GLRX Protein(Met1-Gln106), His-tagged | +Inquiry |
| GLRX-1874R | Recombinant Rhesus monkey GLRX Protein, His-tagged | +Inquiry |
| GLRX-78H | Recombinant Human GLRX | +Inquiry |
| GLRX-4975H | Recombinant Human GLRX Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLRX-5898HCL | Recombinant Human GLRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX Products
Required fields are marked with *
My Review for All GLRX Products
Required fields are marked with *
