Recombinant Human GLRX2 protein, GST-tagged
Cat.No. : | GLRX2-6856H |
Product Overview : | Recombinant Human GLRX2 protein(1-148 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-148 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | RSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GLRX2 glutaredoxin 2 [ Homo sapiens ] |
Official Symbol | GLRX2 |
Synonyms | GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133; |
Gene ID | 51022 |
mRNA Refseq | NM_001243399 |
Protein Refseq | NP_001230328 |
MIM | 606820 |
UniProt ID | Q9NS18 |
◆ Recombinant Proteins | ||
GLRX2-4863H | Recombinant Human GLRX2 protein, GST-tagged | +Inquiry |
GLRX2-4976H | Recombinant Human GLRX2 Protein, GST-tagged | +Inquiry |
GLRX2-5347HF | Recombinant Full Length Human GLRX2 Protein, GST-tagged | +Inquiry |
GLRX2-27694TH | Recombinant Human GLRX2, His-tagged | +Inquiry |
GRX2-76Y | Recombinant Yeast Glutaredoxin 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX2 Products
Required fields are marked with *
My Review for All GLRX2 Products
Required fields are marked with *