"GLRX3" Related Products

Expand
Expand

Recombinant Human GLRX3 protein, T7-tagged

Cat.No.: GLRX3-194H
Product Overview: Recombinant human GLRX3 (335 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFGSMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAK ELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDL NLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGE LIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDI LEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: GLRX3 glutaredoxin 3 [ Homo sapiens ]
Official Symbol: GLRX3
Synonyms: GLRX3; glutaredoxin 3; thioredoxin like 2 , TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; TXNL2; TXNL3; FLJ11864;
Gene ID: 10539
mRNA Refseq: NM_001199868
Protein Refseq: NP_001186797
MIM: 612754
UniProt ID: O76003
Chromosome Location: 10q26
Function: electron carrier activity; iron-sulfur cluster binding; metal ion binding; protein binding; protein disulfide oxidoreductase activity; protein kinase C binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.