Recombinant Human GLS Protein, GST-tagged

Cat.No. : GLS-4979H
Product Overview : Human GLS partial ORF ( NP_055720, 580 a.a. - 669 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM
Molecular Mass : 35.64 kDa
AA Sequence : EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLS glutaminase [ Homo sapiens ]
Official Symbol GLS
Synonyms GLS; glutaminase; glutaminase kidney isoform, mitochondrial; GLS1; KIAA0838; K-glutaminase; glutaminase C; L-glutamine amidohydrolase; glutaminase, phosphate-activated; GAC; GAM; KGA; AAD20; FLJ10358; FLJ41499; DKFZp686D14231; DKFZp686O15119;
Gene ID 2744
mRNA Refseq NM_001256310
Protein Refseq NP_001243239
MIM 138280
UniProt ID O94925

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLS Products

Required fields are marked with *

My Review for All GLS Products

Required fields are marked with *

0
cart-icon
0
compare icon