Recombinant Human GLS Protein, GST-tagged
Cat.No. : | GLS-4979H |
Product Overview : | Human GLS partial ORF ( NP_055720, 580 a.a. - 669 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM |
Molecular Mass : | 35.64 kDa |
AA Sequence : | EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLS glutaminase [ Homo sapiens ] |
Official Symbol | GLS |
Synonyms | GLS; glutaminase; glutaminase kidney isoform, mitochondrial; GLS1; KIAA0838; K-glutaminase; glutaminase C; L-glutamine amidohydrolase; glutaminase, phosphate-activated; GAC; GAM; KGA; AAD20; FLJ10358; FLJ41499; DKFZp686D14231; DKFZp686O15119; |
Gene ID | 2744 |
mRNA Refseq | NM_001256310 |
Protein Refseq | NP_001243239 |
MIM | 138280 |
UniProt ID | O94925 |
◆ Recombinant Proteins | ||
GLS-4979H | Recombinant Human GLS Protein, GST-tagged | +Inquiry |
GLS-1608H | Recombinant Human GLS protein, His-tagged | +Inquiry |
GLS-1609H | Recombinant Human GLS Protein, MYC/DDK-tagged | +Inquiry |
Gls-1608M | Recombinant Mouse Gls protein, His & T7-tagged | +Inquiry |
GLS-3605M | Recombinant Mouse GLS Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLS Products
Required fields are marked with *
My Review for All GLS Products
Required fields are marked with *