Recombinant Human GLS protein, GST-tagged
Cat.No. : | GLS-2971H |
Product Overview : | Recombinant Human GLS protein(O94925)(616-669aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 616-669aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.3 kDa |
AA Sequence : | KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GLS glutaminase [ Homo sapiens ] |
Official Symbol | GLS |
Synonyms | GLS; glutaminase; glutaminase kidney isoform, mitochondrial; GLS1; KIAA0838; K-glutaminase; glutaminase C; L-glutamine amidohydrolase; glutaminase, phosphate-activated; GAC; GAM; KGA; AAD20; FLJ10358; FLJ41499; DKFZp686D14231; DKFZp686O15119; |
Gene ID | 2744 |
mRNA Refseq | NM_001256310 |
Protein Refseq | NP_001243239 |
MIM | 138280 |
UniProt ID | O94925 |
◆ Recombinant Proteins | ||
GLS-2573R | Recombinant Rat GLS Protein | +Inquiry |
GLS-2971H | Recombinant Human GLS protein, GST-tagged | +Inquiry |
GLS-6588H | Recombinant Human GLS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLS-1608H | Recombinant Human GLS protein, His-tagged | +Inquiry |
GLS-08H | Active Recombinant Human GLS Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLS Products
Required fields are marked with *
My Review for All GLS Products
Required fields are marked with *