Recombinant Human GLS protein, GST-tagged

Cat.No. : GLS-2971H
Product Overview : Recombinant Human GLS protein(O94925)(616-669aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 616-669aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.3 kDa
AA Sequence : KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GLS glutaminase [ Homo sapiens ]
Official Symbol GLS
Synonyms GLS; glutaminase; glutaminase kidney isoform, mitochondrial; GLS1; KIAA0838; K-glutaminase; glutaminase C; L-glutamine amidohydrolase; glutaminase, phosphate-activated; GAC; GAM; KGA; AAD20; FLJ10358; FLJ41499; DKFZp686D14231; DKFZp686O15119;
Gene ID 2744
mRNA Refseq NM_001256310
Protein Refseq NP_001243239
MIM 138280
UniProt ID O94925

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLS Products

Required fields are marked with *

My Review for All GLS Products

Required fields are marked with *

0
cart-icon
0
compare icon