Recombinant Human GMEB1 protein, His-tagged
| Cat.No. : | GMEB1-3329H |
| Product Overview : | Recombinant Human GMEB1 protein(216-387 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 216-387 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GMEB1 glucocorticoid modulatory element binding protein 1 [ Homo sapiens ] |
| Official Symbol | GMEB1 |
| Synonyms | GMEB1; glucocorticoid modulatory element binding protein 1; glucocorticoid modulatory element-binding protein 1; P96PIF; PIF96; GMEB-1; PIF p96; DNA-binding protein p96PIF; parvovirus initiation factor p96; |
| Gene ID | 10691 |
| mRNA Refseq | NM_006582 |
| Protein Refseq | NP_006573 |
| MIM | 604409 |
| UniProt ID | Q9Y692 |
| ◆ Recombinant Proteins | ||
| GMEB1-2804H | Recombinant Human GMEB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GMEB1-5006H | Recombinant Human GMEB1 Protein, GST-tagged | +Inquiry |
| GMEB1-3329H | Recombinant Human GMEB1 protein, His-tagged | +Inquiry |
| Gmeb1-3244M | Recombinant Mouse Gmeb1 Protein, Myc/DDK-tagged | +Inquiry |
| GMEB1-2238R | Recombinant Rat GMEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMEB1-5884HCL | Recombinant Human GMEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMEB1 Products
Required fields are marked with *
My Review for All GMEB1 Products
Required fields are marked with *



