Recombinant Human GMFB, His-tagged
Cat.No. : | GMFB-28147TH |
Product Overview : | Recombinant full length Human GMF beta with an N terminal His tag; 162 amino acids with tag, MWt 18.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 142 amino acids |
Description : | Glia maturation factor is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. |
Conjugation : | HIS |
Molecular Weight : | 18.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family. GMF subfamily.Contains 1 ADF-H domain. |
Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
Official Symbol | GMFB |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; |
Gene ID | 2764 |
mRNA Refseq | NM_004124 |
Protein Refseq | NP_004115 |
MIM | 601713 |
Uniprot ID | P60983 |
Chromosome Location | 14q22.2 |
Function | actin binding; enzyme activator activity; growth factor activity; protein kinase inhibitor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GMFB-5010H | Recombinant Human GMFB Protein, GST-tagged | +Inquiry |
GMFB-3746M | Recombinant Mouse GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
GMFB-2580H | Recombinant Human GMFB protein | +Inquiry |
Gmfb-650M | Recombinant Mouse Gmfb | +Inquiry |
GMFB-2240R | Recombinant Rat GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
0
Inquiry Basket