Recombinant Human GMFB, His-tagged

• Cat.No.: GMFB-28147TH
• Product Overview: Recombinant full length Human GMF beta with an N terminal His tag; 162 amino acids with tag, MWt 18.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 142 amino acids
• Description: Glia maturation factor is a nerve growth factor implicated in nervous system development, angiogenesis and immune function.
• Conjugation: HIS
• Molecular Weight: 18.800kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
• Sequence Similarities: Belongs to the actin-binding proteins ADF family. GMF subfamily.Contains 1 ADF-H domain.

Gene Information

• Gene Name: GMFB glia maturation factor, beta [ Homo sapiens ]
• Official Symbol: GMFB
• Synonyms: GMFB; glia maturation factor, beta; glia maturation factor beta; GMF
• Gene ID: 2764
• mRNA Refseq: NM_004124
• Protein Refseq: NP_004115
• MIM: 601713
• Uniprot ID: P60983
• Chromosome Location: 14q22.2
• Function: actin binding; enzyme activator activity; growth factor activity; protein kinase inhibitor activity; signal transducer activity