Recombinant Human GMFB, His-tagged

Cat.No. : GMFB-28147TH
Product Overview : Recombinant full length Human GMF beta with an N terminal His tag; 162 amino acids with tag, MWt 18.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 142 amino acids
Description : Glia maturation factor is a nerve growth factor implicated in nervous system development, angiogenesis and immune function.
Conjugation : HIS
Molecular Weight : 18.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Sequence Similarities : Belongs to the actin-binding proteins ADF family. GMF subfamily.Contains 1 ADF-H domain.
Gene Name GMFB glia maturation factor, beta [ Homo sapiens ]
Official Symbol GMFB
Synonyms GMFB; glia maturation factor, beta; glia maturation factor beta; GMF;
Gene ID 2764
mRNA Refseq NM_004124
Protein Refseq NP_004115
MIM 601713
Uniprot ID P60983
Chromosome Location 14q22.2
Function actin binding; enzyme activator activity; growth factor activity; protein kinase inhibitor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GMFB Products

Required fields are marked with *

My Review for All GMFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon