Recombinant Human GMFB, His-tagged
| Cat.No. : | GMFB-28147TH |
| Product Overview : | Recombinant full length Human GMF beta with an N terminal His tag; 162 amino acids with tag, MWt 18.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 142 amino acids |
| Description : | Glia maturation factor is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. |
| Conjugation : | HIS |
| Molecular Weight : | 18.800kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Sequence Similarities : | Belongs to the actin-binding proteins ADF family. GMF subfamily.Contains 1 ADF-H domain. |
| Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
| Official Symbol | GMFB |
| Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; |
| Gene ID | 2764 |
| mRNA Refseq | NM_004124 |
| Protein Refseq | NP_004115 |
| MIM | 601713 |
| Uniprot ID | P60983 |
| Chromosome Location | 14q22.2 |
| Function | actin binding; enzyme activator activity; growth factor activity; protein kinase inhibitor activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| GMFB-28147TH | Recombinant Human GMFB, His-tagged | +Inquiry |
| GMFB-04H | Recombinant Human Glia Maturation Factor beta | +Inquiry |
| GMFB-2877C | Recombinant Chicken GMFB | +Inquiry |
| GMFB-2585R | Recombinant Rat GMFB Protein | +Inquiry |
| GMFB-2240R | Recombinant Rat GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *



