Recombinant Human GMPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GMPR2-2181H |
Product Overview : | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEACTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GMPR2 guanosine monophosphate reductase 2 [ Homo sapiens (human) ] |
Official Symbol | GMPR2 |
Synonyms | GMPR2; guanosine monophosphate reductase 2; GMP reductase 2; guanosine monophosphate reductase isolog; guanosine 5-monophosphate oxidoreductase 2; MGC830; MGC15084; |
Gene ID | 51292 |
mRNA Refseq | NM_001002001 |
Protein Refseq | NP_001002001 |
MIM | 610781 |
UniProt ID | Q9P2T1 |
◆ Recombinant Proteins | ||
GMPR2-3743Z | Recombinant Zebrafish GMPR2 | +Inquiry |
GMPR2-7008M | Recombinant Mouse GMPR2 Protein | +Inquiry |
GMPR2-4845H | Recombinant Human GMPR2 protein, His-SUMO-tagged | +Inquiry |
GMPR2-956H | Recombinant Human GMPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GMPR2-788H | Recombinant Human Guanosine Monophosphate Reductase 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR2-5874HCL | Recombinant Human GMPR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMPR2 Products
Required fields are marked with *
My Review for All GMPR2 Products
Required fields are marked with *