Recombinant Human GNA14 Protein, GST-tagged
Cat.No. : | GNA14-5026H |
Product Overview : | Human GNA14 full-length ORF (BAG35367.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors |
Molecular Mass : | 65.45 kDa |
AA Sequence : | MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNA14 guanine nucleotide binding protein (G protein), alpha 14 [ Homo sapiens ] |
Official Symbol | GNA14 |
Synonyms | GNA14; guanine nucleotide binding protein (G protein), alpha 14; guanine nucleotide-binding protein subunit alpha-14; g alpha-14; G-protein subunit alpha-14; guanine nucleotide-binding protein 14; |
Gene ID | 9630 |
mRNA Refseq | NM_004297 |
Protein Refseq | NP_004288 |
MIM | 604397 |
UniProt ID | O95837 |
◆ Recombinant Proteins | ||
GNA14-5026H | Recombinant Human GNA14 Protein, GST-tagged | +Inquiry |
GNA14-1090Z | Recombinant Zebrafish GNA14 | +Inquiry |
GNA14-3754M | Recombinant Mouse GNA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNA14-5423HF | Recombinant Full Length Human GNA14 Protein, GST-tagged | +Inquiry |
GNA14-13344H | Recombinant Human GNA14 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNA14-721HCL | Recombinant Human GNA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNA14 Products
Required fields are marked with *
My Review for All GNA14 Products
Required fields are marked with *