Recombinant Human GNAQ protein, GST-tagged
Cat.No. : | GNAQ-13350H |
Product Overview : | Recombinant Human GNAQ protein(NP_002063)(84-205 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 84-205 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GNAQ guanine nucleotide binding protein (G protein), q polypeptide [ Homo sapiens ] |
Official Symbol | GNAQ |
Synonyms | GNAQ; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide-binding protein G(q) subunit alpha; G ALPHA q; GAQ; guanine nucleotide-binding protein alpha-q; G-ALPHA-q; |
Gene ID | 2776 |
mRNA Refseq | NM_002072.3 |
Protein Refseq | NP_002063 |
MIM | 600998 |
UniProt ID | P50148 |
◆ Recombinant Proteins | ||
GNAQ-5831H | Recombinant Human GNAQ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNAQ-7289Z | Recombinant Zebrafish GNAQ | +Inquiry |
GNAQ-32H | Recombinant Human GNAQ Protein, His-tagged | +Inquiry |
GNAQ-88H | Recombinant Human GNAQ Full Length protein, His&Flag-tagged | +Inquiry |
GNAQ-1109HFL | Recombinant Full Length Human GNAQ Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAQ-5867HCL | Recombinant Human GNAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAQ Products
Required fields are marked with *
My Review for All GNAQ Products
Required fields are marked with *