Recombinant Human GNG3
Cat.No. : | GNG3-28960TH |
Product Overview : | Recombinant full length Human G gamma3 with N terminal proprietary tag; Predicted MW 33.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 75 amino acids |
Description : | G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al. |
Molecular Weight : | 33.990kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL |
Sequence Similarities : | Belongs to the G protein gamma family. |
Gene Name | GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ] |
Official Symbol | GNG3 |
Synonyms | GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; |
Gene ID | 2785 |
mRNA Refseq | NM_012202 |
Protein Refseq | NP_036334 |
MIM | 608941 |
Uniprot ID | P63215 |
Chromosome Location | 11p11 |
Pathway | ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; |
Function | G-protein coupled receptor binding; GTPase activity; signal transducer activity; type 1 angiotensin receptor binding; |
◆ Recombinant Proteins | ||
GNG3-1725R | Recombinant Rhesus Macaque GNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG3-28960TH | Recombinant Human GNG3 | +Inquiry |
GNG3-216HF | Recombinant Full Length Human GNG3 Protein | +Inquiry |
GNG3-3774M | Recombinant Mouse GNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG3-5388HF | Recombinant Full Length Human GNG3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG3-5852HCL | Recombinant Human GNG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG3 Products
Required fields are marked with *
My Review for All GNG3 Products
Required fields are marked with *