Recombinant Human GNG5 Protein, GST-tagged

Cat.No. : GNG5-5071H
Product Overview : Human GNG5 full-length ORF ( AAH03563, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]
Molecular Mass : 33.22 kDa
AA Sequence : MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG5 guanine nucleotide binding protein (G protein), gamma 5 [ Homo sapiens ]
Official Symbol GNG5
Synonyms GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393;
Gene ID 2787
mRNA Refseq NM_005274
Protein Refseq NP_005265
MIM 600874
UniProt ID P63218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG5 Products

Required fields are marked with *

My Review for All GNG5 Products

Required fields are marked with *

0
cart-icon
0
compare icon