Recombinant Human GNG5 Protein, SUMO&His-tagged

• Cat.No.: GNG5-1337H
• Product Overview: Recombinant Human GNG5 Protein(P63218)(1-65 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-65 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 19 kDa
• AASequence: MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVC
• Storage: Store at -20°C to -80°C.
• Concentration: 0.1-1.0 mg/ml

Gene Information

• Gene Name: GNG5 guanine nucleotide binding protein (G protein), gamma 5 [ Homo sapiens ]
• Official Symbol: GNG5
• Synonyms: GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393
• Gene ID: 2787
• mRNA Refseq: NM_005274
• Protein Refseq: NP_005265
• MIM: 600874
• UniProt ID: P63218