Recombinant Human GNGT1 Protein, GST-tagged
| Cat.No. : | GNGT1-5076H |
| Product Overview : | Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM |
| Molecular Mass : | 33.88 kDa |
| AA Sequence : | MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNGT1 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [ Homo sapiens ] |
| Official Symbol | GNGT1 |
| Synonyms | GNGT1; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1; guanine nucleotide-binding protein G(T) subunit gamma-T1; GNG1; transducin gamma chain; |
| Gene ID | 2792 |
| mRNA Refseq | NM_021955 |
| Protein Refseq | NP_068774 |
| MIM | 189970 |
| UniProt ID | P63211 |
| ◆ Recombinant Proteins | ||
| GNGT1-5393HF | Recombinant Full Length Human GNGT1 Protein, GST-tagged | +Inquiry |
| GNGT1-1947H | Recombinant Human GNGT1 Protein, MYC/DDK-tagged | +Inquiry |
| GNGT1-10332Z | Recombinant Zebrafish GNGT1 | +Inquiry |
| Gngt1-1031M | Recombinant Mouse Gngt1 Protein, MYC/DDK-tagged | +Inquiry |
| GNGT1-3487H | Recombinant Human GNGT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNGT1-722HCL | Recombinant Human GNGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNGT1 Products
Required fields are marked with *
My Review for All GNGT1 Products
Required fields are marked with *



