Recombinant Human GNGT1 Protein, GST-tagged

• Cat.No.: GNGT1-5076H
• Product Overview: Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM
• Molecular Mass: 33.88 kDa
• AA Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNGT1 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [ Homo sapiens ]
• Official Symbol: GNGT1
• Synonyms: GNGT1; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1; guanine nucleotide-binding protein G(T) subunit gamma-T1; GNG1; transducin gamma chain
• Gene ID: 2792
• mRNA Refseq: NM_021955
• Protein Refseq: NP_068774
• MIM: 189970
• UniProt ID: P63211