Recombinant Human GNGT1 Protein, GST-tagged

Cat.No. : GNGT1-5076H
Product Overview : Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM
Molecular Mass : 33.88 kDa
AA Sequence : MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNGT1 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [ Homo sapiens ]
Official Symbol GNGT1
Synonyms GNGT1; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1; guanine nucleotide-binding protein G(T) subunit gamma-T1; GNG1; transducin gamma chain;
Gene ID 2792
mRNA Refseq NM_021955
Protein Refseq NP_068774
MIM 189970
UniProt ID P63211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNGT1 Products

Required fields are marked with *

My Review for All GNGT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon