Recombinant Full Length Human GNGT1 Protein, GST-tagged
Cat.No. : | GNGT1-5393HF |
Product Overview : | Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 74 amino acids |
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM |
Molecular Mass : | 33.88 kDa |
AA Sequence : | MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNGT1 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [ Homo sapiens ] |
Official Symbol | GNGT1 |
Synonyms | GNGT1; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1; guanine nucleotide-binding protein G(T) subunit gamma-T1; GNG1; transducin gamma chain; |
Gene ID | 2792 |
mRNA Refseq | NM_021955 |
Protein Refseq | NP_068774 |
MIM | 189970 |
UniProt ID | P63211 |
◆ Recombinant Proteins | ||
GNGT1-7042M | Recombinant Mouse GNGT1 Protein | +Inquiry |
Gngt1-1031M | Recombinant Mouse Gngt1 Protein, MYC/DDK-tagged | +Inquiry |
GNGT1-3777M | Recombinant Mouse GNGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNGT1-3487H | Recombinant Human GNGT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNGT1-10332Z | Recombinant Zebrafish GNGT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNGT1-722HCL | Recombinant Human GNGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNGT1 Products
Required fields are marked with *
My Review for All GNGT1 Products
Required fields are marked with *
0
Inquiry Basket