Recombinant Human GNLY Protein, His-tagged
Cat.No. : | GNLY-4835H |
Product Overview : | Recombinant Human GNLY Protein (Arg23-Leu145) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-145 a.a. |
Form : | Lyophilized Powder |
Molecular Mass : | 15.33 kDa |
AA sequence : | MKHHHHHHASRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
Endotoxin : | < 1.0 EU/ug |
Purity : | >95% |
Storage : | Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week. |
Storage buffer : | 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4 |
Reconstitution : | Add 200ul of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture. |
Gene Name | GNLY granulysin [ Homo sapiens ] |
Official Symbol | GNLY |
Synonyms | GNLY; granulysin; LAG2; D2S69E; LAG 2; NKG5; T lymphocyte activation gene 519; TLA519; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519; 519; LAG-2; |
Gene ID | 10578 |
mRNA Refseq | NM_006433 |
Protein Refseq | NP_006424 |
MIM | 188855 |
UniProt ID | P22749 |
◆ Recombinant Proteins | ||
GNLY-4381H | Active Recombinant Human GNLY protein, His-tagged | +Inquiry |
GNLY-4835H | Recombinant Human GNLY Protein, His-tagged | +Inquiry |
GNLY-952H | Recombinant Human GNLY Protein, His-tagged | +Inquiry |
GNLY-4380H | Recombinant Human Granulysin, His-tagged | +Inquiry |
GNLY-4383H | Recombinant Human GNLY protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNLY-5845HCL | Recombinant Human GNLY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNLY Products
Required fields are marked with *
My Review for All GNLY Products
Required fields are marked with *