Recombinant Human GNLY Protein, His-tagged

• Cat.No.: GNLY-4835H
• Product Overview: Recombinant Human GNLY Protein (Arg23-Leu145) was expressed in E. coli with N-terminal His-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-145 a.a.
• Form: Lyophilized Powder
• Molecular Mass: 15.33 kDa
• AA sequence: MKHHHHHHASRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
• Endotoxin: < 1.0 EU/ug
• Purity: >95%
• Storage: Store the lyophilized protein at -80 centigrade. Lyophilized protein remains stable until the expiry date when stored at -80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
• Storage buffer: 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4
• Reconstitution: Add 200ul of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Gene Information

• Gene Name: GNLY granulysin [ Homo sapiens ]
• Official Symbol: GNLY
• Synonyms: GNLY; granulysin; LAG2; D2S69E; LAG 2; NKG5; T lymphocyte activation gene 519; TLA519; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519; 519; LAG-2
• Gene ID: 10578
• mRNA Refseq: NM_006433
• Protein Refseq: NP_006424
• MIM: 188855
• UniProt ID: P22749