Recombinant Human GNPDA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GNPDA2-4679H |
Product Overview : | GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. |
Molecular Mass : | 30.9 kDa |
AA Sequence : | MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens (human) ] |
Official Symbol | GNPDA2 |
Synonyms | GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2; |
Gene ID | 132789 |
mRNA Refseq | NM_138335 |
Protein Refseq | NP_612208 |
MIM | 613222 |
UniProt ID | Q8TDQ7 |
◆ Recombinant Proteins | ||
GNPDA2-5403HF | Recombinant Full Length Human GNPDA2 Protein, GST-tagged | +Inquiry |
GNPDA2-0131H | Recombinant Human GNPDA2 Protein (R2-N276), His tagged | +Inquiry |
GNPDA2-1733R | Recombinant Rhesus Macaque GNPDA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPDA2-0130H | Recombinant Human GNPDA2 Protein (R2-N276), Tag Free | +Inquiry |
GNPDA2-1003H | Recombinant Human GNPDA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA2-5842HCL | Recombinant Human GNPDA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPDA2 Products
Required fields are marked with *
My Review for All GNPDA2 Products
Required fields are marked with *