Recombinant Human GNPDA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GNPDA2-4679H
Product Overview : GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Molecular Mass : 30.9 kDa
AA Sequence : MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens (human) ]
Official Symbol GNPDA2
Synonyms GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2;
Gene ID 132789
mRNA Refseq NM_138335
Protein Refseq NP_612208
MIM 613222
UniProt ID Q8TDQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNPDA2 Products

Required fields are marked with *

My Review for All GNPDA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon