Recombinant Human GOLIM4 Protein, GST-tagged
Cat.No. : | GOLIM4-5115H |
Product Overview : | Human GOLPH4 partial ORF ( NP_055313, 473 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq |
Molecular Mass : | 36.3 kDa |
AA Sequence : | HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GOLIM4 golgi integral membrane protein 4 [ Homo sapiens ] |
Official Symbol | GOLIM4 |
Synonyms | GOLIM4; golgi integral membrane protein 4; golgi phosphoprotein 4, GOLPH4; Golgi integral membrane protein 4; GIMPC; GPP130; P138; golgi phosphoprotein 4; type II Golgi membrane protein; golgi phosphoprotein of 130 kDa; golgi integral membrane protein, cis; 130 kDa golgi-localized phosphoprotein; golgi-localized phosphoprotein of 130 kDa; cis Golgi-localized calcium-binding protein; GOLPH4; |
Gene ID | 27333 |
mRNA Refseq | NM_014498 |
Protein Refseq | NP_055313 |
MIM | 606805 |
UniProt ID | O00461 |
◆ Recombinant Proteins | ||
GOLIM4-5115H | Recombinant Human GOLIM4 Protein, GST-tagged | +Inquiry |
RFL31237HF | Recombinant Full Length Human Golgi Integral Membrane Protein 4(Golim4) Protein, His-Tagged | +Inquiry |
GOLIM4-7855H | Recombinant Human GOLIM4 protein, GST-tagged | +Inquiry |
GOLIM4-7856H | Recombinant Human GOLIM4 protein, His-tagged | +Inquiry |
GOLIM4-7066M | Recombinant Mouse GOLIM4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLIM4 Products
Required fields are marked with *
My Review for All GOLIM4 Products
Required fields are marked with *