Recombinant Human GOLIM4 Protein, GST-tagged

Cat.No. : GOLIM4-5115H
Product Overview : Human GOLPH4 partial ORF ( NP_055313, 473 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq
Molecular Mass : 36.3 kDa
AA Sequence : HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOLIM4 golgi integral membrane protein 4 [ Homo sapiens ]
Official Symbol GOLIM4
Synonyms GOLIM4; golgi integral membrane protein 4; golgi phosphoprotein 4, GOLPH4; Golgi integral membrane protein 4; GIMPC; GPP130; P138; golgi phosphoprotein 4; type II Golgi membrane protein; golgi phosphoprotein of 130 kDa; golgi integral membrane protein, cis; 130 kDa golgi-localized phosphoprotein; golgi-localized phosphoprotein of 130 kDa; cis Golgi-localized calcium-binding protein; GOLPH4;
Gene ID 27333
mRNA Refseq NM_014498
Protein Refseq NP_055313
MIM 606805
UniProt ID O00461

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLIM4 Products

Required fields are marked with *

My Review for All GOLIM4 Products

Required fields are marked with *

0
cart-icon