Recombinant Human GOPC Protein, His-tagged

Cat.No. : GOPC-5118H
Product Overview : Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 278-454 a.a.
Description : PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM
Form : Liquid
Molecular Mass : 21.5 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
Gene Name GOPC golgi-associated PDZ and coiled-coil motif containing [ Homo sapiens ]
Official Symbol GOPC
Synonyms GOPC; golgi-associated PDZ and coiled-coil motif containing; Golgi-associated PDZ and coiled-coil motif-containing protein; CAL; dJ94G16.2; FIG; GOPC1; PIST; dJ94G16.2 PIST; fused in glioblastoma; CFTR-associated ligand; PDZ protein interacting specifically with TC10; Golgi associated PDZ and coiled-coil motif containing protein; PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10;
Gene ID 57120
mRNA Refseq NM_001017408
Protein Refseq NP_001017408
MIM 606845
UniProt ID Q9HD26

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOPC Products

Required fields are marked with *

My Review for All GOPC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon