Recombinant Human GOPC Protein, His-tagged
Cat.No. : | GOPC-5118H |
Product Overview : | Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 278-454 a.a. |
Description : | PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM |
Form : | Liquid |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol) |
Gene Name | GOPC golgi-associated PDZ and coiled-coil motif containing [ Homo sapiens ] |
Official Symbol | GOPC |
Synonyms | GOPC; golgi-associated PDZ and coiled-coil motif containing; Golgi-associated PDZ and coiled-coil motif-containing protein; CAL; dJ94G16.2; FIG; GOPC1; PIST; dJ94G16.2 PIST; fused in glioblastoma; CFTR-associated ligand; PDZ protein interacting specifically with TC10; Golgi associated PDZ and coiled-coil motif containing protein; PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10; |
Gene ID | 57120 |
mRNA Refseq | NM_001017408 |
Protein Refseq | NP_001017408 |
MIM | 606845 |
UniProt ID | Q9HD26 |
◆ Recombinant Proteins | ||
Gopc-3272M | Recombinant Mouse Gopc Protein, Myc/DDK-tagged | +Inquiry |
GOPC-3800M | Recombinant Mouse GOPC Protein, His (Fc)-Avi-tagged | +Inquiry |
GOPC-13393H | Recombinant Human GOPC, GST-tagged | +Inquiry |
GOPC-1941H | Recombinant Human Golgi associated PDZ and coiled-coil motif containing, His-tagged | +Inquiry |
GOPC-27637TH | Recombinant Human GOPC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOPC-5831HCL | Recombinant Human GOPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GOPC Products
Required fields are marked with *
My Review for All GOPC Products
Required fields are marked with *
0
Inquiry Basket