"GPC3" Related Products

Expand
Expand
Expand

Recombinant Human GPC3 Protein, GST-tagged

Cat.No.: GPC3-5147H
Product Overview: Human GPC3 partial ORF ( NP_004475, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.74 kDa
AA Sequence: LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFIS
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GPC3 glypican 3 [ Homo sapiens ]
Official Symbol: GPC3
Synonyms: GPC3; glypican 3; SDYS; glypican-3; DGSX; glypican proteoglycan 3; OCI 5; SGB; SGBS; SGBS1; secreted glypican-3; intestinal protein OCI-5; heparan sulphate proteoglycan; MXR7; OCI-5; GTR2-2;
Gene ID: 2719
mRNA Refseq: NM_001164617
Protein Refseq: NP_001158089
MIM: 300037
UniProt ID: P51654

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.