Recombinant Human GPC3 Protein, GST-tagged
| Cat.No. : | GPC3-5147H |
| Product Overview : | Human GPC3 partial ORF ( NP_004475, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPC3 glypican 3 [ Homo sapiens ] |
| Official Symbol | GPC3 |
| Synonyms | GPC3; glypican 3; SDYS; glypican-3; DGSX; glypican proteoglycan 3; OCI 5; SGB; SGBS; SGBS1; secreted glypican-3; intestinal protein OCI-5; heparan sulphate proteoglycan; MXR7; OCI-5; GTR2-2; |
| Gene ID | 2719 |
| mRNA Refseq | NM_001164617 |
| Protein Refseq | NP_001158089 |
| MIM | 300037 |
| UniProt ID | P51654 |
| ◆ Recombinant Proteins | ||
| GPC3-50CPAF555 | Recombinant Monkey GPC3 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| GPC3-50CAF488 | Recombinant Cynomolgus GPC3 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| GPC3-50CF | Recombinant Cynomolgus GPC3 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| GPC3-186H | Recombinant Human GPC3 Protein, His\Avi-tagged | +Inquiry |
| GPC3-50CAAF488 | Recombinant Cynomolgus GPC3 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPC3-001MCL | Recombinant Mouse GPC3 cell lysate | +Inquiry |
| GPC3-2538HCL | Recombinant Human GPC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPC3 Products
Required fields are marked with *
My Review for All GPC3 Products
Required fields are marked with *
