Recombinant Human GPC6 Protein (24-529 aa), His-tagged
Cat.No. : | GPC6-1403H |
Product Overview : | Recombinant Human GPC6 Protein (24-529 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-529 aa |
Description : | Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases . Enhances migration and invasion of cancer cells through WNT5A signaling.1 Publication |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 59.6 kDa |
AA Sequence : | DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | GPC6 glypican 6 [ Homo sapiens ] |
Official Symbol | GPC6 |
Synonyms | GPC6; glypican 6; glypican-6; OMIMD1; MGC126288; |
Gene ID | 10082 |
mRNA Refseq | NM_005708 |
Protein Refseq | NP_005699 |
MIM | 604404 |
UniProt ID | Q9Y625 |
◆ Recombinant Proteins | ||
GPC6-3058H | Recombinant Human GPC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPC6-5629H | Active Recombinant Human Glypican 6, His-tagged | +Inquiry |
GPC6-2987H | Recombinant Human GPC6 protein, His-SUMO-tagged | +Inquiry |
GPC6-13417H | Recombinant Human GPC6, His-tagged | +Inquiry |
GPC6-1403H | Recombinant Human GPC6 Protein (24-529 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPC6-5811HCL | Recombinant Human GPC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPC6 Products
Required fields are marked with *
My Review for All GPC6 Products
Required fields are marked with *
0
Inquiry Basket