Recombinant Human GPC6 protein, His-SUMO-tagged
Cat.No. : | GPC6-2987H |
Product Overview : | Recombinant Human GPC6 protein(Q9Y625)(24-529aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-529aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.5 kDa |
AA Sequence : | DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GPC6 glypican 6 [ Homo sapiens ] |
Official Symbol | GPC6 |
Synonyms | GPC6; glypican 6; glypican-6; glypican proteoglycan 6; OMIMD1; MGC126288; |
Gene ID | 10082 |
mRNA Refseq | NM_005708 |
Protein Refseq | NP_005699 |
MIM | 604404 |
UniProt ID | Q9Y625 |
◆ Recombinant Proteins | ||
GPC6-3058H | Recombinant Human GPC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPC6-13417H | Recombinant Human GPC6, His-tagged | +Inquiry |
GPC6-1403H | Recombinant Human GPC6 Protein (24-529 aa), His-tagged | +Inquiry |
GPC6-5629H | Active Recombinant Human Glypican 6, His-tagged | +Inquiry |
GPC6-2987H | Recombinant Human GPC6 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPC6-5811HCL | Recombinant Human GPC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPC6 Products
Required fields are marked with *
My Review for All GPC6 Products
Required fields are marked with *
0
Inquiry Basket