Recombinant Human GPI, His-tagged
Cat.No. : | GPI-27616TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-297 a.a. |
Description : | This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 161 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL |
Sequence Similarities : | Belongs to the GPI family. |
Gene Name | GPI glucose-6-phosphate isomerase [ Homo sapiens ] |
Official Symbol | GPI |
Synonyms | GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK; |
Gene ID | 2821 |
mRNA Refseq | NM_000175 |
Protein Refseq | NP_000166 |
MIM | 172400 |
Uniprot ID | P06744 |
Chromosome Location | 19q13.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; |
Function | cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity; |
◆ Recombinant Proteins | ||
Gpi-6874R | Recombinant Rat Gpi protein, His&Myc-tagged | +Inquiry |
GPI-009H | Recombinant Human GPI Protein, His-tagged | +Inquiry |
GPI-2343H | Recombinant Human GPI Protein (Met263-Asn475), N-His tagged | +Inquiry |
GPI-2091M | Recombinant Mouse GPI Protein (2-558 aa), His-B2M-tagged | +Inquiry |
Gpi-723R | Recombinant Rat Gpi protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPI-5806HCL | Recombinant Human GPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPI Products
Required fields are marked with *
My Review for All GPI Products
Required fields are marked with *