Recombinant Human GPI, His-tagged
| Cat.No. : | GPI-27616TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 37-297 a.a. |
| Description : | This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 161 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL |
| Sequence Similarities : | Belongs to the GPI family. |
| Gene Name | GPI glucose-6-phosphate isomerase [ Homo sapiens ] |
| Official Symbol | GPI |
| Synonyms | GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK; |
| Gene ID | 2821 |
| mRNA Refseq | NM_000175 |
| Protein Refseq | NP_000166 |
| MIM | 172400 |
| Uniprot ID | P06744 |
| Chromosome Location | 19q13.1 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; |
| Function | cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity; |
| ◆ Recombinant Proteins | ||
| GPI-2883H | Recombinant Human Full length GPI protein(1-558 aa), C-His-tagged | +Inquiry |
| Gpi-6874R | Recombinant Rat Gpi protein, His&Myc-tagged | +Inquiry |
| GPI-1010H | Recombinant Human GPI Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPI-2294R | Recombinant Rat GPI Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPI-1280C | Recombinant Chicken GPI | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPI-183HKCL | Human GPI Knockdown Cell Lysate | +Inquiry |
| GPI-5806HCL | Recombinant Human GPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPI Products
Required fields are marked with *
My Review for All GPI Products
Required fields are marked with *




