Recombinant Human GPI, His-tagged

Cat.No. : GPI-27616TH
Product Overview : Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 37-297 a.a.
Description : This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 161 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL
Sequence Similarities : Belongs to the GPI family.
Gene Name GPI glucose-6-phosphate isomerase [ Homo sapiens ]
Official Symbol GPI
Synonyms GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK;
Gene ID 2821
mRNA Refseq NM_000175
Protein Refseq NP_000166
MIM 172400
Uniprot ID P06744
Chromosome Location 19q13.1
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem;
Function cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPI Products

Required fields are marked with *

My Review for All GPI Products

Required fields are marked with *

0
cart-icon
0
compare icon