Recombinant Human GPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GPLD1-1383H
Product Overview : GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.
Molecular Mass : 17.3 kDa
AA Sequence : MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GPLD1 glycosylphosphatidylinositol specific phospholipase D1 [ Homo sapiens (human) ]
Official Symbol GPLD1
Synonyms GPLD1; glycosylphosphatidylinositol specific phospholipase D1; phosphatidylinositol-glycan-specific phospholipase D; GPI-PLD; PI-G PLD; GPI-specific phospholipase D; glycoprotein phospholipase D; phospholipase D, phosphatidylinositol-glycan-specific; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; MGC22590;
Gene ID 2822
mRNA Refseq NM_177483
Protein Refseq NP_803436
MIM 602515
UniProt ID P80108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPLD1 Products

Required fields are marked with *

My Review for All GPLD1 Products

Required fields are marked with *

0
cart-icon