Recombinant Human GPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GPLD1-1383H |
Product Overview : | GPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_803436) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSAGDFGTVYLHLLNFLVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GPLD1 glycosylphosphatidylinositol specific phospholipase D1 [ Homo sapiens (human) ] |
Official Symbol | GPLD1 |
Synonyms | GPLD1; glycosylphosphatidylinositol specific phospholipase D1; phosphatidylinositol-glycan-specific phospholipase D; GPI-PLD; PI-G PLD; GPI-specific phospholipase D; glycoprotein phospholipase D; phospholipase D, phosphatidylinositol-glycan-specific; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; MGC22590; |
Gene ID | 2822 |
mRNA Refseq | NM_177483 |
Protein Refseq | NP_803436 |
MIM | 602515 |
UniProt ID | P80108 |
◆ Recombinant Proteins | ||
GPLD1-1383H | Recombinant Human GPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPLD1-434H | Recombinant Human GPLD1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPLD1-5160H | Recombinant Human GPLD1 Protein, GST-tagged | +Inquiry |
GPLD1-5549HF | Recombinant Full Length Human GPLD1 Protein, GST-tagged | +Inquiry |
GPLD1-419HFL | Recombinant Full Length Human GPLD1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPLD1-735HCL | Recombinant Human GPLD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPLD1 Products
Required fields are marked with *
My Review for All GPLD1 Products
Required fields are marked with *