Recombinant Human GPR82 Protein, GST-tagged
Cat.No. : | GPR82-5270H |
Product Overview : | Human GPR82 partial ORF (NP_543007.1, 237 a.a. - 336 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 237-336 a.a. |
Description : | G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM |
Molecular Mass : | 36.63 kDa |
AA Sequence : | IMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR82 G protein-coupled receptor 82 [ Homo sapiens ] |
Official Symbol | GPR82 |
Synonyms | GPR82; G protein-coupled receptor 82; probable G-protein coupled receptor 82; |
Gene ID | 27197 |
mRNA Refseq | NM_080817 |
Protein Refseq | NP_543007 |
MIM | 300748 |
UniProt ID | Q96P67 |
◆ Recombinant Proteins | ||
GPR82-5486HF | Recombinant Full Length Human GPR82 Protein | +Inquiry |
RFL4984MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 82(Gpr82) Protein, His-Tagged | +Inquiry |
GPR82-5269H | Recombinant Human GPR82 Protein | +Inquiry |
RFL15310HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 82(Gpr82) Protein, His-Tagged | +Inquiry |
GPR82-5270H | Recombinant Human GPR82 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR82 Products
Required fields are marked with *
My Review for All GPR82 Products
Required fields are marked with *
0
Inquiry Basket