Recombinant Human GPR82 Protein, GST-tagged
| Cat.No. : | GPR82-5270H |
| Product Overview : | Human GPR82 partial ORF (NP_543007.1, 237 a.a. - 336 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 237-336 a.a. |
| Description : | G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | IMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR82 G protein-coupled receptor 82 [ Homo sapiens ] |
| Official Symbol | GPR82 |
| Synonyms | GPR82; G protein-coupled receptor 82; probable G-protein coupled receptor 82; |
| Gene ID | 27197 |
| mRNA Refseq | NM_080817 |
| Protein Refseq | NP_543007 |
| MIM | 300748 |
| UniProt ID | Q96P67 |
| ◆ Recombinant Proteins | ||
| GPR82-7205M | Recombinant Mouse GPR82 Protein | +Inquiry |
| GPR82-5270H | Recombinant Human GPR82 Protein, GST-tagged | +Inquiry |
| GPR82-5269H | Recombinant Human GPR82 Protein | +Inquiry |
| RFL15310HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 82(Gpr82) Protein, His-Tagged | +Inquiry |
| GPR82-3890M | Recombinant Mouse GPR82 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR82 Products
Required fields are marked with *
My Review for All GPR82 Products
Required fields are marked with *




