Recombinant Human GPR84 Protein
Cat.No. : | GPR84-5272H |
Product Overview : | Human GPR84 full-length ORF (NP_065103.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | GPR84 (G Protein-Coupled Receptor 84) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. |
Form : | Liquid |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR84 G protein-coupled receptor 84 [ Homo sapiens ] |
Official Symbol | GPR84 |
Synonyms | GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4; |
Gene ID | 53831 |
mRNA Refseq | NM_020370 |
Protein Refseq | NP_065103 |
MIM | 606383 |
UniProt ID | Q9NQS5 |
◆ Recombinant Proteins | ||
GPR84-52H | Recombinant Human GPR84 protein, GST-tagged | +Inquiry |
GPR84-6035Z | Recombinant Zebrafish GPR84 | +Inquiry |
RFL20372BF | Recombinant Full Length Bovine G-Protein Coupled Receptor 84(Gpr84) Protein, His-Tagged | +Inquiry |
GPR84-628HF | Recombinant Full Length Human GPR84 Protein | +Inquiry |
GPR84-5490HF | Recombinant Full Length Human GPR84 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR84-5775HCL | Recombinant Human GPR84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR84 Products
Required fields are marked with *
My Review for All GPR84 Products
Required fields are marked with *