Recombinant Human GPR84 Protein

Cat.No. : GPR84-5272H
Product Overview : Human GPR84 full-length ORF (NP_065103.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : GPR84 (G Protein-Coupled Receptor 84) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity.
Form : Liquid
Molecular Mass : 43.7 kDa
AA Sequence : MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
Official Symbol GPR84
Synonyms GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4;
Gene ID 53831
mRNA Refseq NM_020370
Protein Refseq NP_065103
MIM 606383
UniProt ID Q9NQS5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR84 Products

Required fields are marked with *

My Review for All GPR84 Products

Required fields are marked with *

0
cart-icon
0
compare icon