Recombinant Human GPR84 Protein
| Cat.No. : | GPR84-5272H |
| Product Overview : | Human GPR84 full-length ORF (NP_065103.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | GPR84 (G Protein-Coupled Receptor 84) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. |
| Form : | Liquid |
| Molecular Mass : | 43.7 kDa |
| AA Sequence : | MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR84 G protein-coupled receptor 84 [ Homo sapiens ] |
| Official Symbol | GPR84 |
| Synonyms | GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4; |
| Gene ID | 53831 |
| mRNA Refseq | NM_020370 |
| Protein Refseq | NP_065103 |
| MIM | 606383 |
| UniProt ID | Q9NQS5 |
| ◆ Cell & Tissue Lysates | ||
| GPR84-5775HCL | Recombinant Human GPR84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR84 Products
Required fields are marked with *
My Review for All GPR84 Products
Required fields are marked with *
