Recombinant Human GPR84 Protein

• Cat.No.: GPR84-5272H
• Product Overview: Human GPR84 full-length ORF (NP_065103.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: GPR84 (G Protein-Coupled Receptor 84) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity.
• Form: Liquid
• Molecular Mass: 43.7 kDa
• AA Sequence: MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
• Official Symbol: GPR84
• Synonyms: GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4
• Gene ID: 53831
• mRNA Refseq: NM_020370
• Protein Refseq: NP_065103
• MIM: 606383
• UniProt ID: Q9NQS5