"GPR84" Related Products

Recombinant Human GPR84 protein, GST-tagged

Cat.No.: GPR84-52H
Product Overview: Recombinant Human GPR84(208 a.a. - 316 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: GPR84 played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.73 kDa
AA Sequence: AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKR AKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
Official Symbol: GPR84
Synonyms: GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4;
Gene ID: 53831
mRNA Refseq: NM_020370
Protein Refseq: NP_065103
MIM: 606383
UniProt ID: Q9NQS5
Chromosome Location: 12q13.13
Pathway: GPCRs, Other, organism-specific biosystem;
Function: G-protein coupled receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.