Recombinant Human GPR84 protein, GST-tagged GPR84-52H

Cat.No.:	GPR84-52H
Product Overview:	Recombinant Human GPR84(208 a.a. - 316 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description:	GPR84 played an important role in many functions.
Source:	Wheat Germ
Species:	Human
Tag:	GST
Form:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass:	37.73 kDa
AA Sequence:	AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKR AKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
Applications:	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Download Datasheet

Gene Name:	GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
Official Symbol:	GPR84
Synonyms:	GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4;
Gene ID:	53831
mRNA Refseq:	NM_020370
Protein Refseq:	NP_065103
MIM:	606383
UniProt ID:	Q9NQS5
Chromosome Location:	12q13.13
Pathway:	GPCRs, Other, organism-specific biosystem;
Function:	G-protein coupled receptor activity; receptor activity; signal transducer activity;