Recombinant Human GPR84 protein, GST-tagged
Cat.No. : | GPR84-52H |
Product Overview : | Recombinant Human GPR84(208 a.a. - 316 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 208-316 a.a. |
Description : | GPR84 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKR AKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GPR84 G protein-coupled receptor 84 [ Homo sapiens ] |
Official Symbol | GPR84 |
Synonyms | GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4; |
Gene ID | 53831 |
mRNA Refseq | NM_020370 |
Protein Refseq | NP_065103 |
MIM | 606383 |
UniProt ID | Q9NQS5 |
Chromosome Location | 12q13.13 |
Pathway | GPCRs, Other, organism-specific biosystem; |
Function | G-protein coupled receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GPR84-6035Z | Recombinant Zebrafish GPR84 | +Inquiry |
GPR84-3892M | Recombinant Mouse GPR84 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR84-628HF | Recombinant Full Length Human GPR84 Protein | +Inquiry |
GPR84-52H | Recombinant Human GPR84 protein, GST-tagged | +Inquiry |
GPR84-5490HF | Recombinant Full Length Human GPR84 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR84-5775HCL | Recombinant Human GPR84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR84 Products
Required fields are marked with *
My Review for All GPR84 Products
Required fields are marked with *