Recombinant Human GPRC5C protein, His-tagged
| Cat.No. : | GPRC5C-3701H |
| Product Overview : | Recombinant Human GPRC5C protein(301-433 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-433 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GPRC5C G protein-coupled receptor, family C, group 5, member C [ Homo sapiens ] |
| Official Symbol | GPRC5C |
| Synonyms | GPRC5C; G protein-coupled receptor, family C, group 5, member C; G-protein coupled receptor family C group 5 member C; RAIG 3; orphan G-protein coupled receptor; retinoic acid-induced gene 3 protein; retinoic acid responsive gene protein; RAIG3; RAIG-3; MGC131820; |
| Gene ID | 55890 |
| mRNA Refseq | NM_018653 |
| Protein Refseq | NP_061123 |
| MIM | 605949 |
| UniProt ID | Q9NQ84 |
| ◆ Cell & Tissue Lysates | ||
| GPRC5C-748HCL | Recombinant Human GPRC5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5C Products
Required fields are marked with *
My Review for All GPRC5C Products
Required fields are marked with *



