Recombinant Human GPT, His-tagged
| Cat.No. : | GPT-26390TH |
| Product Overview : | Recombinant full-length Human Alanine Transaminase with a N terminal His tag. 516 amino acids with a predicted MWt 56.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 496 amino acids |
| Description : | This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. |
| Conjugation : | HIS |
| Molecular Weight : | 56.800kDa inclusive of tags |
| Tissue specificity : | Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKV LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKK PFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSP NFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDV ARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEG HTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAW ALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTREC IEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKV LMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNM DAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDP SFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQG AMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETG ICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH AKFTLEYS |
| Sequence Similarities : | Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily. |
| Gene Name | GPT glutamic-pyruvate transaminase (alanine aminotransferase) [ Homo sapiens ] |
| Official Symbol | GPT |
| Synonyms | GPT; glutamic-pyruvate transaminase (alanine aminotransferase); alanine aminotransferase 1; ALT1; GPT1; |
| Gene ID | 2875 |
| mRNA Refseq | NM_005309 |
| Protein Refseq | NP_005300 |
| MIM | 138200 |
| Uniprot ID | P24298 |
| Chromosome Location | 8q24.2-qter |
| Pathway | Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | 1-aminocyclopropane-1-carboxylate synthase activity; L-alanine:2-oxoglutarate aminotransferase activity; L-alanine:2-oxoglutarate aminotransferase activity; pyridoxal phosphate binding; transaminase activity; |
| ◆ Recombinant Proteins | ||
| Gpt-374M | Recombinant Mouse Gpt Protein, His-tagged | +Inquiry |
| GPT-1015H | Recombinant Human GPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPT-5572HF | Recombinant Full Length Human GPT Protein, GST-tagged | +Inquiry |
| GPT-2493H | Recombinant Human GPT protein, His-tagged | +Inquiry |
| Gpt-131M | Active Recombinant Mouse Gpt protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
| GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
| GPT-26879TH | Native Human GPT | +Inquiry |
| GPT-1840H | Active Native Human GPT | +Inquiry |
| GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPT-721RCL | Recombinant Rat GPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPT Products
Required fields are marked with *
My Review for All GPT Products
Required fields are marked with *



