Recombinant Human GPT, His-tagged
Cat.No. : | GPT-26390TH |
Product Overview : | Recombinant full-length Human Alanine Transaminase with a N terminal His tag. 516 amino acids with a predicted MWt 56.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 496 amino acids |
Description : | This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. |
Conjugation : | HIS |
Molecular Weight : | 56.800kDa inclusive of tags |
Tissue specificity : | Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKV LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKK PFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSP NFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDV ARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEG HTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAW ALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTREC IEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKV LMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNM DAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDP SFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQG AMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETG ICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH AKFTLEYS |
Sequence Similarities : | Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily. |
Gene Name | GPT glutamic-pyruvate transaminase (alanine aminotransferase) [ Homo sapiens ] |
Official Symbol | GPT |
Synonyms | GPT; glutamic-pyruvate transaminase (alanine aminotransferase); alanine aminotransferase 1; ALT1; GPT1; |
Gene ID | 2875 |
mRNA Refseq | NM_005309 |
Protein Refseq | NP_005300 |
MIM | 138200 |
Uniprot ID | P24298 |
Chromosome Location | 8q24.2-qter |
Pathway | Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | 1-aminocyclopropane-1-carboxylate synthase activity; L-alanine:2-oxoglutarate aminotransferase activity; L-alanine:2-oxoglutarate aminotransferase activity; pyridoxal phosphate binding; transaminase activity; |
◆ Recombinant Proteins | ||
GPT-1283H | Recombinant Human Glutamic-Pyruvate Transaminase (Alanine Aminotransferase), His-tagged | +Inquiry |
Gpt-44R | Recombinant Rat Gpt protein, His-tagged | +Inquiry |
GPT-4845H | Recombinant Human GPT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPT-33H | Active Recombinant Human GPT | +Inquiry |
GPT-2493H | Recombinant Human GPT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPT-721RCL | Recombinant Rat GPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPT Products
Required fields are marked with *
My Review for All GPT Products
Required fields are marked with *
0
Inquiry Basket