Recombinant Human GPX1 Protein, GST-tagged
Cat.No. : | GPX1-5308H |
Product Overview : | Human GPX1 full-length ORF ( NP_000572.2, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPX1 glutathione peroxidase 1 [ Homo sapiens ] |
Official Symbol | GPX1 |
Synonyms | GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245; |
Gene ID | 2876 |
mRNA Refseq | NM_000581 |
Protein Refseq | NP_000572 |
MIM | 138320 |
UniProt ID | P07203 |
◆ Recombinant Proteins | ||
GPX1-18H | Recombinant Human GPX1 Protein, 203 residues | +Inquiry |
GPX1-3901M | Recombinant Mouse GPX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX1-2677R | Recombinant Rat GPX1 Protein | +Inquiry |
GPX1-2990H | Recombinant Human GPX1 protein, His-SUMO-tagged | +Inquiry |
GPX1-29073TH | Recombinant Human GPX1, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPX1-8429H | Native Human GPX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX1-5763HCL | Recombinant Human GPX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX1 Products
Required fields are marked with *
My Review for All GPX1 Products
Required fields are marked with *
0
Inquiry Basket