Recombinant Human GPX1 Protein, GST-tagged
Cat.No. : | GPX1-5308H |
Product Overview : | Human GPX1 full-length ORF ( NP_000572.2, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | GPX1 glutathione peroxidase 1 [ Homo sapiens ] |
Official Symbol : | GPX1 |
Synonyms : | GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245; |
Gene ID : | 2876 |
mRNA Refseq : | NM_000581 |
Protein Refseq : | NP_000572 |
MIM : | 138320 |
UniProt ID : | P07203 |
Products Types
◆ Recombinant Protein | ||
Gpx1-1585R | Recombinant Rat Gpx1 Protein, His-tagged | +Inquiry |
GPX1-3901M | Recombinant Mouse GPX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gpx1-1584M | Recombinant Mouse Gpx1 Protein, His&GST-tagged | +Inquiry |
GPX1-2331R | Recombinant Rat GPX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX1-22H | Recombinant Human GPX1 Protein | +Inquiry |
◆ Native Protein | ||
GPX1-8429H | Native Human GPX1 | +Inquiry |
◆ Lysates | ||
GPX1-5763HCL | Recombinant Human GPX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket