Recombinant Human GPX5 Protein (1-100 aa), His-Trx-tagged
| Cat.No. : | GPX5-2142H |
| Product Overview : | Recombinant Human GPX5 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-Trx tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Trx |
| Protein Length : | 1-100 aa |
| Description : | Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.4 kDa |
| AA Sequence : | MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ] |
| Official Symbol | GPX5 |
| Synonyms | GPX5; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; |
| Gene ID | 2880 |
| mRNA Refseq | NM_001509 |
| Protein Refseq | NP_001500 |
| MIM | 603435 |
| UniProt ID | O75715 |
| ◆ Recombinant Proteins | ||
| GPX5-1786R | Recombinant Rhesus Macaque GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPX5-7233M | Recombinant Mouse GPX5 Protein | +Inquiry |
| GPX5-5583HF | Recombinant Full Length Human GPX5 Protein, GST-tagged | +Inquiry |
| Gpx5-1107R | Recombinant Rat Gpx5 protein, His-tagged | +Inquiry |
| GPX5-5312H | Recombinant Human GPX5 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX5 Products
Required fields are marked with *
My Review for All GPX5 Products
Required fields are marked with *



