Recombinant Human GPX5 Protein, GST-tagged
| Cat.No. : | GPX5-5312H |
| Product Overview : | Human GPX5 full-length ORF ( NP_003987.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike mRNAs for other characterized glutathione peroxidases, this mRNA does not contain a selenocysteine (UGA) codon. Thus, the encoded protein is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq |
| Molecular Mass : | 37.8 kDa |
| AA Sequence : | MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ] |
| Official Symbol | GPX5 |
| Synonyms | GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein; |
| Gene ID | 2880 |
| mRNA Refseq | NM_001509 |
| Protein Refseq | NP_001500 |
| MIM | 603435 |
| UniProt ID | O75715 |
| ◆ Recombinant Proteins | ||
| GPX5-7233M | Recombinant Mouse GPX5 Protein | +Inquiry |
| GPX5-2156P | Recombinant Pig GPX5 Protein (22-219 aa), His-Myc-tagged | +Inquiry |
| GPX5-4280H | Recombinant Human GPX5 protein, His-GST-tagged | +Inquiry |
| GPX5-2169P | Recombinant Pig GPX5 Protein (22-219 aa), His-SUMO-Myc-tagged | +Inquiry |
| GPX5-564C | Recombinant Cynomolgus GPX5 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX5 Products
Required fields are marked with *
My Review for All GPX5 Products
Required fields are marked with *
