Recombinant Human GPX7
| Cat.No. : | GPX7-29079TH |
| Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 187 amino acids |
| Molecular Weight : | 46.640kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL |
| Sequence Similarities : | Belongs to the glutathione peroxidase family. |
| Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
| Official Symbol | GPX7 |
| Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; |
| Gene ID | 2882 |
| mRNA Refseq | NM_015696 |
| Protein Refseq | NP_056511 |
| Uniprot ID | Q96SL4 |
| Chromosome Location | 1p32 |
| Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem; |
| Function | glutathione peroxidase activity; oxidoreductase activity; |
| ◆ Recombinant Proteins | ||
| GPX7-7341H | Recombinant Human GPX7 protein(Met1-Leu187), hFc-tagged | +Inquiry |
| GPX7-29079TH | Recombinant Human GPX7 | +Inquiry |
| GPX7-1391H | Recombinant Human Glutathione Peroxidase 7, His-tagged | +Inquiry |
| GPX7-2699Z | Recombinant Zebrafish GPX7 | +Inquiry |
| GPX7-204HF | Recombinant Full Length Human GPX7 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *
