Recombinant Human GPX8 protein, His-tagged
Cat.No. : | GPX8-3565H |
Product Overview : | Recombinant Human GPX8 protein(38-209 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-209 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ] |
Official Symbol | GPX8 |
Synonyms | GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8; |
Gene ID | 493869 |
mRNA Refseq | NM_001008397 |
Protein Refseq | NP_001008398 |
UniProt ID | Q8TED1 |
◆ Recombinant Proteins | ||
GPX8-96H | Recombinant Human GPX8, His-tagged | +Inquiry |
GPX8-7236M | Recombinant Mouse GPX8 Protein | +Inquiry |
GPX8-5589HF | Recombinant Full Length Human GPX8 Protein, GST-tagged | +Inquiry |
GPX8-10562Z | Recombinant Zebrafish GPX8 | +Inquiry |
RFL13796TF | Recombinant Full Length Tetraodon Nigroviridis Probable Glutathione Peroxidase 8(Gpx8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX8-5761HCL | Recombinant Human GPX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX8 Products
Required fields are marked with *
My Review for All GPX8 Products
Required fields are marked with *