Recombinant Human GRB14 Protein, GST-tagged
Cat.No. : | GRB14-5037H |
Product Overview : | Human GRB14 partial ORF ( NP_004481, 25 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. This protein likely has an inhibitory effect on receptor tyrosine kinase signaling and, in particular, on insulin receptor signaling. This gene may play a role in signaling pathways that regulate growth and metabolism. Transcript variants have been reported for this gene, but their full-length natures have not been determined to date. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDLDVPEMPSIPNPFPELCCSPITSVLSADLFPKANSRKKQVIKVYSEDETSRALDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRB14 growth factor receptor-bound protein 14 [ Homo sapiens ] |
Official Symbol | GRB14 |
Synonyms | GRB14; growth factor receptor-bound protein 14; GRB14 adapter protein; |
Gene ID | 2888 |
mRNA Refseq | NM_004490 |
Protein Refseq | NP_004481 |
MIM | 601524 |
UniProt ID | Q14449 |
◆ Recombinant Proteins | ||
GRB14-538H | Recombinant Human GRB14 Protein, MYC/DDK-tagged | +Inquiry |
Grb14-1737R | Recombinant Rat Grb14 protein, His & T7-tagged | +Inquiry |
Grb14-3303M | Recombinant Mouse Grb14 Protein, Myc/DDK-tagged | +Inquiry |
GRB14-13519H | Recombinant Human GRB14 protein, His-tagged | +Inquiry |
GRB14-2339R | Recombinant Rat GRB14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRB14-5756HCL | Recombinant Human GRB14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRB14 Products
Required fields are marked with *
My Review for All GRB14 Products
Required fields are marked with *