Recombinant Human GRB14 Protein, GST-tagged

Cat.No. : GRB14-5037H
Product Overview : Human GRB14 partial ORF ( NP_004481, 25 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. This protein likely has an inhibitory effect on receptor tyrosine kinase signaling and, in particular, on insulin receptor signaling. This gene may play a role in signaling pathways that regulate growth and metabolism. Transcript variants have been reported for this gene, but their full-length natures have not been determined to date. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : QVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDLDVPEMPSIPNPFPELCCSPITSVLSADLFPKANSRKKQVIKVYSEDETSRALDV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRB14 growth factor receptor-bound protein 14 [ Homo sapiens ]
Official Symbol GRB14
Synonyms GRB14; growth factor receptor-bound protein 14; GRB14 adapter protein;
Gene ID 2888
mRNA Refseq NM_004490
Protein Refseq NP_004481
MIM 601524
UniProt ID Q14449

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRB14 Products

Required fields are marked with *

My Review for All GRB14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon