Recombinant Human GREM2 Protein, His-tagged

• Cat.No.: GREM2-534H
• Product Overview: Recombinant Human GREM2 Protein (22-168 aa) with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-168 aa
• Description: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 18 kDa
• AASequence: MRKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQGGGGSHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: GREM2 gremlin 2 [ Homo sapiens (human) ]
• Official Symbol: GREM2
• Synonyms: GREM2; gremlin 2; gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis); gremlin-2; CKTSF1B2; DAND3; FLJ21195; Prdc; protein related to DAN and cerberus; DAN domain family member 3; cysteine knot superfamily 1, BMP antagonist 2; gremlin 2, cysteine knot superfamily, homolog; PRDC
• Gene ID: 64388
• mRNA Refseq: NM_022469
• Protein Refseq: NP_071914
• MIM: 608832
• UniProt ID: Q9H772