Recombinant Human GRIA1 protein, His-tagged
Cat.No. : | GRIA1-2641H |
Product Overview : | Recombinant Human GRIA1 protein(125-249 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125-249 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
Official Symbol | GRIA1 |
Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252; |
Gene ID | 2890 |
mRNA Refseq | NM_000827 |
Protein Refseq | NP_000818 |
MIM | 138248 |
UniProt ID | P42261 |
◆ Recombinant Proteins | ||
GRIA1-2701H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
GRIA1-1794R | Recombinant Rhesus Macaque GRIA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIA1-1521H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
GRIA1-1801H | Recombinant Human GRIA1 protein, GST-tagged | +Inquiry |
GRIA1-2641H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *