Recombinant Human GRIA1

• Cat.No.: GRIA1-29069TH
• Product Overview: Recombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 with a proprietary tag; Predicted MWt 36.63.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Widely expressed in brain.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
• Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.

Gene Information

• Gene Name: GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
• Official Symbol: GRIA1
• Synonyms: GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GLURA
• Gene ID: 2890
• mRNA Refseq: NM_000827
• Protein Refseq: NP_000818
• MIM: 138248
• Uniprot ID: P42261
• Chromosome Location: 5q33
• Pathway: Activation of AMPA receptors, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Dopaminergic synapse, organism-specific biosystem
• Function: PDZ domain binding; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; glutamate receptor activity; ion channel activity