Recombinant Human GRIA1
Cat.No. : | GRIA1-29069TH |
Product Overview : | Recombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 with a proprietary tag; Predicted MWt 36.63. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed in brain. |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily. |
Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
Official Symbol | GRIA1 |
Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GLURA; |
Gene ID | 2890 |
mRNA Refseq | NM_000827 |
Protein Refseq | NP_000818 |
MIM | 138248 |
Uniprot ID | P42261 |
Chromosome Location | 5q33 |
Pathway | Activation of AMPA receptors, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; |
Function | PDZ domain binding; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; glutamate receptor activity; ion channel activity; |
◆ Recombinant Proteins | ||
Gria1-1062M | Recombinant Mouse Gria1 Protein, MYC/DDK-tagged | +Inquiry |
GRIA1-2701H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
GRIA1-2760H | Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged | +Inquiry |
GRIA1-2343R | Recombinant Rat GRIA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIA1-2641H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *
0
Inquiry Basket