Recombinant Human GRIA1
| Cat.No. : | GRIA1-29069TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 with a proprietary tag; Predicted MWt 36.63. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Widely expressed in brain. |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM |
| Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily. |
| Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
| Official Symbol | GRIA1 |
| Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GLURA; |
| Gene ID | 2890 |
| mRNA Refseq | NM_000827 |
| Protein Refseq | NP_000818 |
| MIM | 138248 |
| Uniprot ID | P42261 |
| Chromosome Location | 5q33 |
| Pathway | Activation of AMPA receptors, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; |
| Function | PDZ domain binding; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; glutamate receptor activity; ion channel activity; |
| ◆ Recombinant Proteins | ||
| GRIA1-2701H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
| GRIA1-5330H | Recombinant Human GRIA1 Protein, GST-tagged | +Inquiry |
| GRIA1-2760H | Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged | +Inquiry |
| GRIA1-236HFL | Active Recombinant Full Length Human GRIA1 Protein, C-Flag-tagged | +Inquiry |
| GRIA1-2761H | Recombinant Human GRIA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *
