Recombinant Human GRIA1

Cat.No. : GRIA1-29069TH
Product Overview : Recombinant fragment corresponding to amino acids 201-300 of Human Glutamate Receptor 1 with a proprietary tag; Predicted MWt 36.63.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Widely expressed in brain.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Sequence Similarities : Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA1 subfamily.
Gene Name GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
Official Symbol GRIA1
Synonyms GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GLURA;
Gene ID 2890
mRNA Refseq NM_000827
Protein Refseq NP_000818
MIM 138248
Uniprot ID P42261
Chromosome Location 5q33
Pathway Activation of AMPA receptors, organism-specific biosystem; Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Dopaminergic synapse, organism-specific biosystem;
Function PDZ domain binding; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; glutamate receptor activity; ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIA1 Products

Required fields are marked with *

My Review for All GRIA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon