Recombinant Human GRIA4 protein(731-800 aa), C-His-tagged

Cat.No. : GRIA4-2770H
Product Overview : Recombinant Human GRIA4 protein(P48058)(731-800 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 731-800 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS
Gene Name GRIA4 glutamate receptor, ionotropic, AMPA 4 [ Homo sapiens ]
Official Symbol GRIA4
Synonyms GRIA4; glutamate receptor, ionotropic, AMPA 4; GLUR4, glutamate receptor, ionotrophic, AMPA 4; glutamate receptor 4; GluA4; GLURD; gluR-4; gluR-D; AMPA-selective glutamate receptor 4; glutamate receptor, ionotrophic, AMPA 4; GLUR4; GLUR4C;
Gene ID 2893
mRNA Refseq NM_000829
Protein Refseq NP_000820
MIM 138246
UniProt ID P48058

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIA4 Products

Required fields are marked with *

My Review for All GRIA4 Products

Required fields are marked with *

0
cart-icon