Recombinant Human GRIA4 protein(731-800 aa), C-His-tagged
| Cat.No. : | GRIA4-2770H |
| Product Overview : | Recombinant Human GRIA4 protein(P48058)(731-800 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 731-800 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS |
| Gene Name | GRIA4 glutamate receptor, ionotropic, AMPA 4 [ Homo sapiens ] |
| Official Symbol | GRIA4 |
| Synonyms | GRIA4; glutamate receptor, ionotropic, AMPA 4; GLUR4, glutamate receptor, ionotrophic, AMPA 4; glutamate receptor 4; GluA4; GLURD; gluR-4; gluR-D; AMPA-selective glutamate receptor 4; glutamate receptor, ionotrophic, AMPA 4; GLUR4; GLUR4C; |
| Gene ID | 2893 |
| mRNA Refseq | NM_000829 |
| Protein Refseq | NP_000820 |
| MIM | 138246 |
| UniProt ID | P48058 |
| ◆ Recombinant Proteins | ||
| GRIA4-3076H | Recombinant Human GRIA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRIA4-954H | Recombinant Human GRIA4 Protein, His&SUMO-tagged | +Inquiry |
| GRIA4-6767C | Recombinant Chicken GRIA4 | +Inquiry |
| GRIA4-5333H | Recombinant Human GRIA4 Protein, GST-tagged | +Inquiry |
| GRIA4-3797C | Recombinant Chicken GRIA4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA4 Products
Required fields are marked with *
My Review for All GRIA4 Products
Required fields are marked with *
