Recombinant Human GRIA4 protein(731-800 aa), C-His-tagged
Cat.No. : | GRIA4-2770H |
Product Overview : | Recombinant Human GRIA4 protein(P48058)(731-800 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 731-800 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS |
Gene Name | GRIA4 glutamate receptor, ionotropic, AMPA 4 [ Homo sapiens ] |
Official Symbol | GRIA4 |
Synonyms | GRIA4; glutamate receptor, ionotropic, AMPA 4; GLUR4, glutamate receptor, ionotrophic, AMPA 4; glutamate receptor 4; GluA4; GLURD; gluR-4; gluR-D; AMPA-selective glutamate receptor 4; glutamate receptor, ionotrophic, AMPA 4; GLUR4; GLUR4C; |
Gene ID | 2893 |
mRNA Refseq | NM_000829 |
Protein Refseq | NP_000820 |
MIM | 138246 |
UniProt ID | P48058 |
◆ Recombinant Proteins | ||
GRIA4-216H | Recombinant Human GRIA4 | +Inquiry |
GRIA4-6767C | Recombinant Chicken GRIA4 | +Inquiry |
GRIA4-3797C | Recombinant Chicken GRIA4 | +Inquiry |
GRIA4-5333H | Recombinant Human GRIA4 Protein, GST-tagged | +Inquiry |
GRIA4-3076H | Recombinant Human GRIA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA4 Products
Required fields are marked with *
My Review for All GRIA4 Products
Required fields are marked with *