Recombinant Human GRIA4 Protein, GST-tagged
Cat.No. : | GRIA4-5333H |
Product Overview : | Human GRIA4 full-length ORF ( NP_001070712.1, 1 a.a. - 433 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia. [provided by RefSeq |
Molecular Mass : | 75.5 kDa |
AA Sequence : | MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIA4 glutamate receptor, ionotropic, AMPA 4 [ Homo sapiens ] |
Official Symbol | GRIA4 |
Synonyms | GRIA4; glutamate receptor, ionotropic, AMPA 4; GLUR4, glutamate receptor, ionotrophic, AMPA 4; glutamate receptor 4; GluA4; GLURD; gluR-4; gluR-D; AMPA-selective glutamate receptor 4; glutamate receptor, ionotrophic, AMPA 4; GLUR4; GLUR4C; |
Gene ID | 2893 |
mRNA Refseq | NM_000829 |
Protein Refseq | NP_000820 |
MIM | 138246 |
UniProt ID | P48058 |
◆ Recombinant Proteins | ||
GRIA4-2770H | Recombinant Human GRIA4 protein(731-800 aa), C-His-tagged | +Inquiry |
GRIA4-954H | Recombinant Human GRIA4 Protein, His&SUMO-tagged | +Inquiry |
GRIA4-3797C | Recombinant Chicken GRIA4 | +Inquiry |
GRIA4-6767C | Recombinant Chicken GRIA4 | +Inquiry |
GRIA4-3213H | Recombinant Human GRIA4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIA4 Products
Required fields are marked with *
My Review for All GRIA4 Products
Required fields are marked with *
0
Inquiry Basket