Recombinant Human GRIN1 Protein, GST-tagged
Cat.No. : | GRIN1-5344H |
Product Overview : | Human GRIN1 partial ORF ( NP_015566, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ] |
Official Symbol | GRIN1 |
Synonyms | GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1; |
Gene ID | 2902 |
mRNA Refseq | NM_000832 |
Protein Refseq | NP_000823 |
MIM | 138249 |
UniProt ID | Q05586 |
◆ Recombinant Proteins | ||
GRIN1-2994H | Recombinant Human GRIN1 protein(19-559aa), 10xHis-tagged | +Inquiry |
GRIN1-5344H | Recombinant Human GRIN1 Protein, GST-tagged | +Inquiry |
GRIN1-2992H | Recombinant Human GRIN1 protein(19-559aa), 6xHis-tagged | +Inquiry |
GRIN1-1905H | Recombinant Human GRIN1 protein, His-tagged | +Inquiry |
GRIN1-2361H | Recombinant Human GRIN1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIN1-5745HCL | Recombinant Human GRIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN1 Products
Required fields are marked with *
My Review for All GRIN1 Products
Required fields are marked with *