Recombinant Human GRIN1 Protein, GST-tagged

Cat.No. : GRIN1-5344H
Product Overview : Human GRIN1 partial ORF ( NP_015566, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRIN1 glutamate receptor, ionotropic, N-methyl D-aspartate 1 [ Homo sapiens ]
Official Symbol GRIN1
Synonyms GRIN1; glutamate receptor, ionotropic, N-methyl D-aspartate 1; NMDAR1; glutamate [NMDA] receptor subunit zeta-1; GluN1; NMD-R1; glutamate [NMDA] receptor subunit zeta 1; N-methyl-D-aspartate receptor subunit NR1; N-methyl-D-aspartate receptor channel, subunit zeta-1; NR1; MRD8; NMDA1;
Gene ID 2902
mRNA Refseq NM_000832
Protein Refseq NP_000823
MIM 138249
UniProt ID Q05586

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIN1 Products

Required fields are marked with *

My Review for All GRIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon