Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged
| Cat.No. : | GRIN2A-1264H |
| Product Overview : | Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 501-550 aa & 601-630 aa & 701-750 aa |
| Description : | NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 18.2 kDa |
| AA Sequence : | VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
| Official Symbol | GRIN2A |
| Synonyms | GRIN2A; NMDAR2A; GluN2A; hNR2A; EPND; NR2A; |
| Gene ID | 2903 |
| mRNA Refseq | NM_000833 |
| Protein Refseq | NP_000824 |
| MIM | 138253 |
| UniProt ID | Q12879 |
| ◆ Recombinant Proteins | ||
| GRIN2A-7270M | Recombinant Mouse GRIN2A Protein | +Inquiry |
| GRIN2A-4399H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
| GRIN2A-1353H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
| GRIN2A-1264H | Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged | +Inquiry |
| GRIN2A-5732H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *
