Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged
Cat.No. : | GRIN2A-1264H |
Product Overview : | Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 501-550 aa & 601-630 aa & 701-750 aa |
Description : | NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.2 kDa |
AA Sequence : | VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
Official Symbol | GRIN2A |
Synonyms | GRIN2A; NMDAR2A; GluN2A; hNR2A; EPND; NR2A; |
Gene ID | 2903 |
mRNA Refseq | NM_000833 |
Protein Refseq | NP_000824 |
MIM | 138253 |
UniProt ID | Q12879 |
◆ Recombinant Proteins | ||
GRIN2A-3931M | Recombinant Mouse GRIN2A Protein, His (Fc)-Avi-tagged | +Inquiry |
Grin2a-1591R | Recombinant Rat Grin2a protein, His-tagged | +Inquiry |
GRIN2A-7270M | Recombinant Mouse GRIN2A Protein | +Inquiry |
GRIN2A-4399H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
GRIN2A-1264H | Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *
0
Inquiry Basket