Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged

Cat.No. : GRIN2A-1264H
Product Overview : Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 501-550 aa & 601-630 aa & 701-750 aa
Description : NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.2 kDa
AA Sequence : VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ]
Official Symbol GRIN2A
Synonyms GRIN2A; NMDAR2A; GluN2A; hNR2A; EPND; NR2A;
Gene ID 2903
mRNA Refseq NM_000833
Protein Refseq NP_000824
MIM 138253
UniProt ID Q12879

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIN2A Products

Required fields are marked with *

My Review for All GRIN2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon