Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged

• Cat.No.: GRIN2A-1264H
• Product Overview: Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 501-550 aa & 601-630 aa & 701-750 aa
• Description: NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.2 kDa
• AA Sequence: VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ]
• Official Symbol: GRIN2A
• Synonyms: GRIN2A; NMDAR2A; GluN2A; hNR2A; EPND; NR2A
• Gene ID: 2903
• mRNA Refseq: NM_000833
• Protein Refseq: NP_000824
• MIM: 138253
• UniProt ID: Q12879