Recombinant Human GRIN2A protein(971-1050 aa), C-His-tagged
Cat.No. : | GRIN2A-2835H |
Product Overview : | Recombinant Human GRIN2A protein(Q12879)(971-1050 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 971-1050 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR |
Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
Official Symbol | GRIN2A |
Synonyms | GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A; |
Gene ID | 2903 |
mRNA Refseq | NM_000833 |
Protein Refseq | NP_000824 |
MIM | 138253 |
UniProt ID | Q12879 |
◆ Recombinant Proteins | ||
GRIN2A-2543H | Recombinant Human GRIN2A Protein (Pro401-Arg539), N-His tagged | +Inquiry |
GRIN2A-2835H | Recombinant Human GRIN2A protein(971-1050 aa), C-His-tagged | +Inquiry |
GRIN2A-1353H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
Grin2a-1590M | Recombinant Mouse Grin2a Protein, His-tagged | +Inquiry |
Grin2a-1591R | Recombinant Rat Grin2a protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *