Recombinant Human GRIN2A protein(971-1050 aa), C-His-tagged
| Cat.No. : | GRIN2A-2835H |
| Product Overview : | Recombinant Human GRIN2A protein(Q12879)(971-1050 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 971-1050 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR |
| Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
| Official Symbol | GRIN2A |
| Synonyms | GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A; |
| Gene ID | 2903 |
| mRNA Refseq | NM_000833 |
| Protein Refseq | NP_000824 |
| MIM | 138253 |
| UniProt ID | Q12879 |
| ◆ Recombinant Proteins | ||
| GRIN2A-7270M | Recombinant Mouse GRIN2A Protein | +Inquiry |
| Grin2a-1590M | Recombinant Mouse Grin2a Protein, His-tagged | +Inquiry |
| GRIN2A-4399H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
| GRIN2A-1353H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
| GRIN2A-5733H | Recombinant Human GRIN2A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *



