Recombinant Human GRIN2A protein(971-1050 aa), C-His-tagged

Cat.No. : GRIN2A-2835H
Product Overview : Recombinant Human GRIN2A protein(Q12879)(971-1050 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 971-1050 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR
Gene Name GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ]
Official Symbol GRIN2A
Synonyms GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A;
Gene ID 2903
mRNA Refseq NM_000833
Protein Refseq NP_000824
MIM 138253
UniProt ID Q12879

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIN2A Products

Required fields are marked with *

My Review for All GRIN2A Products

Required fields are marked with *

0
cart-icon
0
compare icon