Recombinant Human GRIN2A protein(971-1050 aa), C-His-tagged

• Cat.No.: GRIN2A-2835H
• Product Overview: Recombinant Human GRIN2A protein(Q12879)(971-1050 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 971-1050 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR

Gene Information

• Gene Name: GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ]
• Official Symbol: GRIN2A
• Synonyms: GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A
• Gene ID: 2903
• mRNA Refseq: NM_000833
• Protein Refseq: NP_000824
• MIM: 138253
• UniProt ID: Q12879