Recombinant Human GRIN2A protein, His-tagged
| Cat.No. : | GRIN2A-4399H |
| Product Overview : | Recombinant Human GRIN2A protein(Q12879)(23-555aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-555aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.2 kDa |
| AA Sequence : | VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
| Official Symbol | GRIN2A |
| Synonyms | GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A; |
| Gene ID | 2903 |
| mRNA Refseq | NM_000833 |
| Protein Refseq | NP_000824 |
| MIM | 138253 |
| UniProt ID | Q12879 |
| ◆ Recombinant Proteins | ||
| GRIN2A-3931M | Recombinant Mouse GRIN2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRIN2A-7270M | Recombinant Mouse GRIN2A Protein | +Inquiry |
| GRIN2A-5733H | Recombinant Human GRIN2A protein, GST-tagged | +Inquiry |
| GRIN2A-4399H | Recombinant Human GRIN2A protein, His-tagged | +Inquiry |
| GRIN2A-301466H | Recombinant Human GRIN2A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *



