Recombinant Human GRIN2A protein, His-tagged
Cat.No. : | GRIN2A-4399H |
Product Overview : | Recombinant Human GRIN2A protein(Q12879)(23-555aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-555aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ] |
Official Symbol | GRIN2A |
Synonyms | GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A; |
Gene ID | 2903 |
mRNA Refseq | NM_000833 |
Protein Refseq | NP_000824 |
MIM | 138253 |
UniProt ID | Q12879 |
◆ Recombinant Proteins | ||
Grin2a-1590M | Recombinant Mouse Grin2a Protein, His-tagged | +Inquiry |
GRIN2A-3931M | Recombinant Mouse GRIN2A Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIN2A-2545H | Recombinant Human GRIN2A Protein (Pro23-Ala555), His tagged | +Inquiry |
Grin2a-1591R | Recombinant Rat Grin2a protein, His-tagged | +Inquiry |
GRIN2A-1264H | Recombinant Human GRIN2A Protein (501-550 aa & 601-630 aa & 701-750 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIN2A Products
Required fields are marked with *
My Review for All GRIN2A Products
Required fields are marked with *