Recombinant Human GRIN2A protein, His-tagged

• Cat.No.: GRIN2A-4399H
• Product Overview: Recombinant Human GRIN2A protein(Q12879)(23-555aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-555aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.2 kDa
• AA Sequence: VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GRIN2A glutamate receptor, ionotropic, N-methyl D-aspartate 2A [ Homo sapiens ]
• Official Symbol: GRIN2A
• Synonyms: GRIN2A; glutamate receptor, ionotropic, N-methyl D-aspartate 2A; NMDAR2A; glutamate [NMDA] receptor subunit epsilon-1; GluN2A; hNR2A; NMDA receptor subtype 2A; N-methyl D-aspartate receptor subtype 2A; N-methyl-D-aspartate receptor subunit 2A; N-methyl-D-aspartate receptor channel, subunit epsilon-1; EPND; NR2A
• Gene ID: 2903
• mRNA Refseq: NM_000833
• Protein Refseq: NP_000824
• MIM: 138253
• UniProt ID: Q12879