Recombinant Human GRIN2B Protein, GST-tagged

Cat.No. : GRIN2B-5345H
Product Overview : Human GRIN2B partial ORF ( NP_000825, 127 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of three different subunits: NR1 (GRIN1), NR2 (GRIN2A, GRIN2B, GRIN2C, or GRIN2D) and NR3 (GRIN3A or GRIN3B). The NR2 subunit acts as the agonist binding site for glutamate. This receptor is the predominant excitatory neurotransmitter receptor in the mammalian brain. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRIN2B glutamate receptor, ionotropic, N-methyl D-aspartate 2B [ Homo sapiens ]
Official Symbol GRIN2B
Synonyms GRIN2B; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; NMDAR2B; glutamate [NMDA] receptor subunit epsilon-2; GluN2B; NR3; glutamate receptor subunit epsilon-2; N-methyl-D-aspartate receptor subunit 3; N-methyl D-aspartate receptor subtype 2B; MRD6; NR2B; hNR3; MGC142178; MGC142180;
Gene ID 2904
mRNA Refseq NM_000834
Protein Refseq NP_000825
MIM 138252
UniProt ID Q13224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIN2B Products

Required fields are marked with *

My Review for All GRIN2B Products

Required fields are marked with *

0
cart-icon
0
compare icon