Recombinant Human GRK1 Protein, GST-tagged
Cat.No. : | GRK1-5352H |
Product Overview : | Human GRK1 partial ORF ( NP_002920.1, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRK1 G protein-coupled receptor kinase 1 [ Homo sapiens ] |
Official Symbol | GRK1 |
Synonyms | GRK1; G protein-coupled receptor kinase 1; rhodopsin kinase, RHOK; rhodopsin kinase; GPRK1; RK; RHOK; |
Gene ID | 6011 |
mRNA Refseq | NM_002929 |
Protein Refseq | NP_002920 |
MIM | 180381 |
UniProt ID | Q15835 |
◆ Recombinant Proteins | ||
GRK1-2364R | Recombinant Rat GRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRK1-1018H | Recombinant Human G Protein-Coupled Receptor Kinase 1, GST-tagged | +Inquiry |
GRK1-5352H | Recombinant Human GRK1 Protein, GST-tagged | +Inquiry |
GRK1-71HFL | Active Recombinant Full Length Human GRK1 Protein, N-His-tagged | +Inquiry |
GRK1-2710R | Recombinant Rat GRK1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRK1-5739HCL | Recombinant Human GRK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK1 Products
Required fields are marked with *
My Review for All GRK1 Products
Required fields are marked with *
0
Inquiry Basket