Recombinant Human GRK1 Protein, GST-tagged
| Cat.No. : | GRK1-5352H |
| Product Overview : | Human GRK1 partial ORF ( NP_002920.1, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | RDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GRK1 G protein-coupled receptor kinase 1 [ Homo sapiens ] |
| Official Symbol | GRK1 |
| Synonyms | GRK1; G protein-coupled receptor kinase 1; rhodopsin kinase, RHOK; rhodopsin kinase; GPRK1; RK; RHOK; |
| Gene ID | 6011 |
| mRNA Refseq | NM_002929 |
| Protein Refseq | NP_002920 |
| MIM | 180381 |
| UniProt ID | Q15835 |
| ◆ Recombinant Proteins | ||
| GRK1-1409H | Active Recombinant Human GRK1, GST-tagged | +Inquiry |
| GRK1-5352H | Recombinant Human GRK1 Protein, GST-tagged | +Inquiry |
| GRK1-2710R | Recombinant Rat GRK1 Protein | +Inquiry |
| GRK1-27928TH | Recombinant Human GRK1 | +Inquiry |
| Grk1-3311M | Recombinant Mouse Grk1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRK1-5739HCL | Recombinant Human GRK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK1 Products
Required fields are marked with *
My Review for All GRK1 Products
Required fields are marked with *
