Recombinant Human GRK7 Protein, GST-tagged
Cat.No. : | GRK7-5361H |
Product Overview : | Human GRK7 full-length ORF ( AAI52978.1, 1 a.a. - 553 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation. [provided by RefSeq |
Molecular Mass : | 87.78 kDa |
AA Sequence : | MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEKEILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQIACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPEILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFTEEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRK7 G protein-coupled receptor kinase 7 [ Homo sapiens ] |
Official Symbol | GRK7 |
Synonyms | GRK7; G protein-coupled receptor kinase 7; GPRK7; g protein-coupled receptor kinase GRK7; |
Gene ID | 131890 |
mRNA Refseq | NM_139209 |
Protein Refseq | NP_631948 |
MIM | 606987 |
UniProt ID | Q8WTQ7 |
◆ Recombinant Proteins | ||
GRK7-5361H | Recombinant Human GRK7 Protein, GST-tagged | +Inquiry |
GRK7-5576HF | Recombinant Full Length Human GRK7 Protein, GST-tagged | +Inquiry |
GRK7-1021H | Recombinant Human G Protein-Coupled Receptor Kinase 7, GST-tagged | +Inquiry |
GRK7-8988HF | Active Recombinant Full Length Human GRK7 Protein, GST-tagged | +Inquiry |
GRK7-147H | Recombinant Human GRK7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRK7-753HCL | Recombinant Human GRK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRK7 Products
Required fields are marked with *
My Review for All GRK7 Products
Required fields are marked with *
0
Inquiry Basket