Recombinant Human GRM2 Protein, GST-tagged
| Cat.No. : | GRM2-5365H |
| Product Overview : | Human GRM2 partial ORF ( NP_000830, 414 a.a. - 506 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 35.97 kDa |
| AA Sequence : | NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GRM2 glutamate receptor, metabotropic 2 [ Homo sapiens ] |
| Official Symbol | GRM2 |
| Synonyms | GRM2; glutamate receptor, metabotropic 2; metabotropic glutamate receptor 2; GPRC1B; mGlu2; MGLUR2; glutamate receptor homolog; glutamate metabotropic receptor 2; GLUR2; |
| Gene ID | 2912 |
| mRNA Refseq | NM_000839 |
| Protein Refseq | NP_000830 |
| MIM | 604099 |
| UniProt ID | Q14416 |
| ◆ Recombinant Proteins | ||
| GRM2-5365H | Recombinant Human GRM2 Protein, GST-tagged | +Inquiry |
| GRM2-0394H | Recombinant Human GRM2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| GRM2-1798R | Recombinant Rhesus Macaque GRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRM2-3940M | Recombinant Mouse GRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRM2-2368R | Recombinant Rat GRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRM2-5736HCL | Recombinant Human GRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRM2 Products
Required fields are marked with *
My Review for All GRM2 Products
Required fields are marked with *
